DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Lbx1

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001040573.1 Gene:Lbx1 / 499362 RGDID:1564197 Length:285 Species:Rattus norvegicus


Alignment Length:390 Identity:93/390 - (23%)
Similarity:135/390 - (34%) Gaps:143/390 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LGHFPPTAGGNG----------LNVAQYAAAMQQHYAAAAAAAAARNNAAAAAAAAAAAAAAGVA 226
            |.|.||.|..|.          ||    ..::::.|              :...||...|||...
  Rat    20 LDHLPPPANSNKPLTPFSIEDILN----KPSVRRSY--------------SLCGAAHLLAAADKH 66

  Fly   227 APPVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMDDHSV-CSNGGKDDDGNSVKSGSTS 290
            ||       ||:   |.||..|...:......|:..|.......| .....:..||.::.....:
  Rat    67 AP-------GGL---PLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQT 121

  Fly   291 DMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWK 355
                 .||:||:|||||:||:..|||.|..|||||..:|.::|.:|.|::.||.||:||||.|.|
  Rat   122 -----PKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLK 181

  Fly   356 RQTAVGLELLAEAGNFAAFQRLYGGSPYLGAWPYAAAAGAAHGATPHTNIDIYYRQAAAAAAMQK 420
            |                                                 |:...:|...:|.: 
  Rat   182 R-------------------------------------------------DLEEMKADVESAKK- 196

  Fly   421 PLPYNLYAGVPSVGVGVGVGVGPAPFSHLSASSSLSSLSSYYQSAAAAASAANPGGPHPVAPPPS 485
                                :||      |....:.:|:...|::.|:..    ||         
  Rat   197 --------------------LGP------SGQMDIVALAELEQNSEASGG----GG--------- 222

  Fly   486 VGGGSPPSGLVKPIPAHSASASPPPRPPSTPSP---TLNPGSP---PGRSVDSCSQSDDEDQIQV 544
             |||....|..|..|   .|.:.||..|..|..   .|:|.||   ...|...||:.:::::|.|
  Rat   223 -GGGGGGCGRAKSRP---GSPALPPGAPQAPGGGPLQLSPASPLTDQRASSQDCSEDEEDEEIDV 283

  Fly   545  544
              Rat   284  283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 29/51 (57%)
Lbx1NP_001040573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 6/15 (40%)
Homeobox 128..181 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..285 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.