DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Tlx3

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_573065.4 Gene:Tlx3 / 497881 RGDID:1564190 Length:291 Species:Rattus norvegicus


Alignment Length:252 Identity:73/252 - (28%)
Similarity:100/252 - (39%) Gaps:65/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PSALHHPQPHPP----------THPHTHPHALMHPHGK--LGHFPPTAGGNGLNVAQYAAAMQQH 196
            |::...|.||.|          :.......|...|.|.  ||. ||  ||      :..||....
  Rat     4 PASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGG-PP--GG------RPGAAYPSL 59

  Fly   197 YAAAAAAAAARNNAAAAAAAAAAAAAAGVAAP---PVDGGVDGGVGLAPPAGGDLDDSSDYHEEN 258
            .|:.|...|...:|.:.:...:.|.|..:..|   |:.|.|...:..|.||...:.         
  Rat    60 PASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVP--------- 115

  Fly   259 EDCDSGNMDDHSVCSNGG-----KDDDGNSVKSGSTSD----------------MSGLSKKQRKA 302
                       :|.|.||     .:.....||...|:.                .:....|::|.
  Rat   116 -----------TVSSLGGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKP 169

  Fly   303 RTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTA 359
            ||:|:..|:..|||.|.|||||:..||..||..|.::|.|||||:|||||||:||||
  Rat   170 RTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 30/51 (59%)
Tlx3XP_573065.4 Homeobox 169..223 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.