DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and lbe

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster


Alignment Length:513 Identity:115/513 - (22%)
Similarity:151/513 - (29%) Gaps:262/513 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ASNVAGVGVLPSAL---HHPQPHPPTHPHTHPHALMHPHGKLGHFPPTAGGNGLNVAQYAAAMQQ 195
            |.:...||..||.|   ||      ||||:|||.|.||.           .:.:::.|....:.|
  Fly    13 AESEISVGGAPSPLPTQHH------THPHSHPHPLQHPR-----------ASTIDLLQQQQLLMQ 60

  Fly   196 HYAAAAAAAAARNNAAAAAAA-----------------------------------------AAA 219
            |:|||||||||..:....:|.                                         ...
  Fly    61 HHAAAAAAAAAAASGLTRSAVGNLPEDYFHPLKRLRMSSSSSEPRDHTPSPPSAVPEPQTNQTTK 125

  Fly   220 AAAAGV-------------------AAPPVDGGVDGGVGLAPPA-------GGDLDDSS------ 252
            :|..||                   .:||.:..:     |||||       ||.|...:      
  Fly   126 SAIEGVKSFSIADILGHSEKQREESVSPPPNANL-----LAPPASRPIAPSGGLLQPRTEPLDVH 185

  Fly   253 ---------------------------------------------DYHEE--------------- 257
                                                         |||.:               
  Fly   186 PAAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPSALLHYEQRLALDYHRQLQEHFNAQAQLLRHM 250

  Fly   258 --------NEDCDSGNMDDHSVCSNG--------------------GKDD----------DGNSV 284
                    :|| .|......|..|||                    |.::          .|:..
  Fly   251 GMNPAIIASED-GSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGSGK 314

  Fly   285 KSGST----------------SDMSGLS--------KKQRKARTAFTDHQLQTLEKSFERQKYLS 325
            .:|.|                .|.|.|.        ||:||:|||||:||:..|||.|..|||||
  Fly   315 SNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLS 379

  Fly   326 VQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGNFAAFQRLYGGSPYLGAWPYA 390
            ..:|.|:|..|.||:.||.||:||||.|.||...   ||..:..:...|                
  Fly   380 PADRDEIAASLGLSNAQVITWFQNRRAKQKRDIE---ELKKDFDSVKVF---------------- 425

  Fly   391 AAAGAAHGA--------------TPHTNIDIYYRQAAAAAAMQKPLPYNLYAGVPSVG 434
                :||.:              ..|.:..:....|||||.|..|:|    ..||..|
  Fly   426 ----SAHKSFLENVNDLSILKKKPMHESDMVGLAAAAAAAGMVVPVP----GSVPMGG 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 31/51 (61%)
lbeNP_524435.2 Homeobox 356..410 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.