DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Nanog

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001094251.1 Gene:Nanog / 414065 RGDID:1303178 Length:312 Species:Rattus norvegicus


Alignment Length:130 Identity:49/130 - (37%)
Similarity:71/130 - (54%) Gaps:25/130 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 PPAGGD--LDDSSDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQRKART 304
            ||:.||  |.||.|           :..:..:..:|.:.|:|...|    .:...|:||| |.||
  Rat    55 PPSSGDLPLQDSPD-----------SSSNPKLKLSGPEADEGPEKK----EENKVLTKKQ-KMRT 103

  Fly   305 AFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKR-------QTAVGL 362
            .|:..||..|:..|:||:|||:|:.|:|:..|:||..|||||:||:|.|.||       :|:.||
  Rat   104 VFSQAQLCALKDRFQRQRYLSLQQMQDLSTILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGL 168

  Fly   363  362
              Rat   169  168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 28/55 (51%)
NanogNP_001094251.1 Homeodomain 100..155 CDD:459649 28/54 (52%)
PTZ00395 <184..>291 CDD:185594
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.