DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and mnx2a

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001009886.2 Gene:mnx2a / 406205 ZFINID:ZDB-GENE-040415-1 Length:309 Species:Danio rerio


Alignment Length:69 Identity:37/69 - (53%)
Similarity:45/69 - (65%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 STSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRT 352
            |.:..|||..|.|:.|||||..||..||..|:..||||..:|.|:|..|.|::.|||.|:||||.
Zfish   139 SGAPQSGLIGKCRRPRTAFTSQQLLELENQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRM 203

  Fly   353 KWKR 356
            ||||
Zfish   204 KWKR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 30/55 (55%)
mnx2aNP_001009886.2 Homeodomain 151..207 CDD:459649 30/55 (55%)

Return to query results.
Submit another query.