DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and hhex

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_989420.1 Gene:hhex / 395060 XenbaseID:XB-GENE-487159 Length:274 Species:Xenopus tropicalis


Alignment Length:59 Identity:32/59 - (54%)
Similarity:41/59 - (69%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKR 356
            |::..:..|::.|...|||.||.|||||..||:.||..|.||:.|||||:||||.||:|
 Frog   138 KRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 30/55 (55%)
hhexNP_989420.1 Homeodomain 138..196 CDD:459649 31/57 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..274 32/59 (54%)

Return to query results.
Submit another query.