DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and ventx1.2

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_988861.1 Gene:ventx1.2 / 394455 XenbaseID:XB-GENE-920868 Length:262 Species:Xenopus tropicalis


Alignment Length:102 Identity:46/102 - (45%)
Similarity:63/102 - (61%) Gaps:10/102 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 SGNMDDHSVCSNGGKDDDG--NSVKSGSTSDMSGLSKK-----QRKARTAFTDHQLQTLEKSFER 320
            ||:.|:.   |..|.:|||  :|.::...:|....||.     ||:.|||||..|:..||::|.:
 Frog    87 SGSSDEF---SPAGSEDDGTESSGRNSQENDTEHRSKSPKSDLQRRLRTAFTPQQITRLEQAFNK 148

  Fly   321 QKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQ 357
            |:||...||::||..|.||:.|||||:||||.|.|||
 Frog   149 QRYLGASERKKLATSLQLSEIQVKTWFQNRRMKLKRQ 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 29/51 (57%)
ventx1.2NP_988861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..129 13/44 (30%)
Homeobox 131..183 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.