DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and NKX1-2

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001139812.1 Gene:NKX1-2 / 390010 HGNCID:31652 Length:310 Species:Homo sapiens


Alignment Length:318 Identity:87/318 - (27%)
Similarity:116/318 - (36%) Gaps:89/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 QHYAAAAAAAA------ARNNAAAAAAAAAAAAAAGVAAPPVDGGVDGGVGLAPP-AGGDLDDSS 252
            |.:..||..|.      ||.:.|...|...|::...|...........|.|.|.| .|.:.::..
Human    29 QKFTRAALPAVRPAPREARKSLAEVEAGKDASSRDPVRQLETPDAAGPGAGQASPLEGSEAEEEE 93

  Fly   253 DYHE------------------ENEDCDSGNMDDHSVCSNGGKDDDGNSVKSGSTSDMSGLSK-- 297
            |..:                  .:.|..:|.:.....|.:||    |..|:|...|..|...:  
Human    94 DAEDPRRPRLRERAARLLPGLARSPDAPAGALASGEPCEDGG----GGPVRSPPGSPGSPRPRRR 154

  Fly   298 -------KQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWK 355
                   |.|:||||||..||..||..|...:||||.||..||..|.|::.|||.|:||||||||
Human   155 RLEPNCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWK 219

  Fly   356 RQTAVGLELLAEAGNFAAFQRLYGGSPYLGAWPYAAAAGAAHGATPHTNIDIYYRQAAAAAAMQK 420
            :|.. |.:..|:.|         ||:|..||  .....|...|.:|                   
Human   220 KQNP-GADGAAQVG---------GGAPQPGA--AGGGGGGGSGGSP------------------- 253

  Fly   421 PLPYNLYAGVPSVGVGVGVGVGPAPFSHLSASSSLSSLSSYYQSAAA-AASAANPGGP 477
                    |.|..|.           .|.....|.|:.:..:.|||: ..:||.||.|
Human   254 --------GPPGTGA-----------LHFQTFPSYSAANVLFPSAASFPLTAAAPGSP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 30/51 (59%)
NKX1-2NP_001139812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..165 24/132 (18%)
Homeobox 167..219 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..260 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.