DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Noto

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001007473.1 Gene:Noto / 384452 MGIID:3053002 Length:240 Species:Mus musculus


Alignment Length:81 Identity:32/81 - (39%)
Similarity:49/81 - (60%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 VKSGSTSDM--SGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTW 346
            :|...|.|:  .|..:..::.||.|...|||.|||.|.:|..|..:||.:||.:|.|::.||:.|
Mouse   132 LKWAPTVDLRDHGTERHTKRVRTTFNLQQLQELEKVFAKQHNLVGKERAQLAARLHLTENQVRIW 196

  Fly   347 YQNRRTKWKRQTAVGL 362
            :||||.|:::|..:.|
Mouse   197 FQNRRVKYQKQQKLKL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 26/55 (47%)
NotoNP_001007473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Homeodomain 150..206 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..240 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.