DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and ved

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_898897.1 Gene:ved / 368201 ZFINID:ZDB-GENE-030813-1 Length:278 Species:Danio rerio


Alignment Length:195 Identity:56/195 - (28%)
Similarity:84/195 - (43%) Gaps:29/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 SDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKS----GSTSDMSGLSKKQ--RKARTAFTDHQ 310
            |.:....||      ::.|.|.:.|...:|:..:|    ||.:..||.....  |:.||||:..|
Zfish    93 SGFSSSTED------EELSGCESEGSRSEGSGSRSPAAPGSVAPASGSGSPSSGRRPRTAFSSEQ 151

  Fly   311 LQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTAVGLELLAE---AGNFA 372
            :.:||:.|:|..||..|::.||...|.|:|.|::.|:||||.|.||.....|....:   |.:..
Zfish   152 ISSLERVFKRNAYLGAQDKAELCRTLKLTDKQIRNWFQNRRMKLKRTVQDSLAQACQVKVASHMM 216

  Fly   373 AFQRLYG--GSPYLGAWPYAAAAGAAHGATPHTNIDIYYRQAAAAAAMQKPLPYNLYAGVPSVGV 435
            .:..|:.  .:||...:|...||.|...........:||..            |....||||:.|
Zfish   217 HYSDLHSFRAAPYPSFYPETPAAFAPPYPISPAAESLYYSS------------YQNLQGVPSIPV 269

  Fly   436  435
            Zfish   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 24/51 (47%)
vedNP_898897.1 Homeobox 145..196 CDD:278475 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.