DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and scro

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:65 Identity:17/65 - (26%)
Similarity:27/65 - (41%) Gaps:12/65 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RMDTDVIKLIES-KHEV--TILGGLNEFCVKFFGPRGTPYEGGVWKVRVHLPEHYPFKSPSIGFI 71
            |::..:.||.|| |.|:  .::..|:         ||...:..||.|.:......|..|.||..:
  Fly   400 RLEGFLQKLCESGKLEILSKVISSLH---------RGIAGDADVWSVMIPTMCKEPVISDSIDLL 455

  Fly    72  71
              Fly   456  455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649
scroNP_001015473.1 Homeodomain 254..310 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.