DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and CG11085

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster


Alignment Length:362 Identity:109/362 - (30%)
Similarity:150/362 - (41%) Gaps:93/362 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 FMINDILAGSAAAAFYKQQQHHQQLHHHNNNNNSGSSGGSSPAHSNNNNNINGDNCEASNVAGVG 141
            |:|.|:|..     ...::|...:|...|::::......|:|               .|..||..
  Fly     7 FLIRDLLGD-----LINRRQTDSELELSNDDSDIDIEDRSTP---------------DSTAAGCQ 51

  Fly   142 VLPSALHHPQ---PHPPTHPHTHPHALMHPHGKLGHFPPTAGGNGLNVAQYAAAMQQHYAAAAAA 203
            ......||.:   .|..:...:...|...|....|......||.|..||.         ..:|||
  Fly    52 QELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVAS---------GLSAAA 107

  Fly   204 AAARNNAAAAAAAAAAAAAAGVAAPPVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMDD 268
            |||  ..||...||||:.|.|      |...:||.|  |.:||.              .||...:
  Fly   108 AAA--GVAAGLLAAAASGANG------DRDANGGSG--PGSGGG--------------TSGGYAE 148

  Fly   269 HSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELA 333
            |.:                   .:|...:|.|:.|||||..||..||:.|..||||||.:|.::|
  Fly   149 HKL-------------------QLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVA 194

  Fly   334 HKLDLSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGNFAAFQRLY-----GGSPYLGAWP----- 388
            ..|:||:.||||||||||||||||..:.||.|...   |..::.:     ||:..||..|     
  Fly   195 ETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQ---ATMEKDFVVQDGGGAGGLGCCPSGLSS 256

  Fly   389 -YAAAAGAAHGATPHTNIDIYYRQAAAAAAMQKPLPY 424
             ::|||.||..|:...|    :..:|||||:.:.:.|
  Fly   257 SFSAAAAAAAAASNPCN----FLTSAAAAAIFRNVGY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 33/51 (65%)
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
43.810

Return to query results.
Submit another query.