Sequence 1: | NP_523387.1 | Gene: | B-H1 / 32724 | FlyBaseID: | FBgn0011758 | Length: | 544 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011538046.1 | Gene: | TLX1 / 3195 | HGNCID: | 5056 | Length: | 342 | Species: | Homo sapiens |
Alignment Length: | 304 | Identity: | 77/304 - (25%) |
---|---|---|---|
Similarity: | 98/304 - (32%) | Gaps: | 114/304 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 159 HTHPHALMHPHGKLGHFPPTAGG--NGLNVAQYAAAM-------QQHYAAAAAAAAARNNAAAAA 214
Fly 215 AAAAAAAAAGVAAPPVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMD---DHSVCSNGG 276
Fly 277 KDDDGNSVKSG-------------------------------------------STSDMSGLS-- 296
Fly 297 -----------------------------------KKQRKARTAFTDHQLQTLEKSFERQKYLSV 326
Fly 327 QERQELAHKLDLSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGN 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
B-H1 | NP_523387.1 | Homeobox | 303..355 | CDD:278475 | 31/51 (61%) |
TLX1 | XP_011538046.1 | Homeobox | 216..269 | CDD:278475 | 31/52 (60%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |