DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and hoxa13b

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_571269.2 Gene:hoxa13b / 30438 ZFINID:ZDB-GENE-980526-365 Length:289 Species:Danio rerio


Alignment Length:77 Identity:25/77 - (32%)
Similarity:42/77 - (54%) Gaps:12/77 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 DGNSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVK 344
            ||.||:.|            ||.|..:|..||:.||:.:...|:::..:|:.::...:|::.||.
Zfish   216 DGASVRRG------------RKKRVPYTKVQLKELEREYATNKFITKDKRRRISAHTNLTERQVT 268

  Fly   345 TWYQNRRTKWKR 356
            .|:||||.|.|:
Zfish   269 IWFQNRRVKEKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 19/55 (35%)
hoxa13bNP_571269.2 HoxA13_N 27..131 CDD:463521
Homeodomain 224..280 CDD:459649 19/55 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.