DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and hoxc3a

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001128157.3 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio


Alignment Length:79 Identity:32/79 - (40%)
Similarity:46/79 - (58%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 NSVKSGSTSDMSG----LSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQ 342
            |:::||.:...:|    .:...::||.|||..||..|||.|....||....|.|:|..|.|:|.|
Zfish   137 NAMESGDSKYSNGEAVVRNSSSKRARVAFTSSQLLELEKEFHFSAYLCRNRRLEMAELLKLTDRQ 201

  Fly   343 VKTWYQNRRTKWKR 356
            :|.|:||||.|:|:
Zfish   202 IKIWFQNRRMKYKK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 27/55 (49%)
hoxc3aNP_001128157.3 None

Return to query results.
Submit another query.