DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and dbx1b

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_571253.1 Gene:dbx1b / 30416 ZFINID:ZDB-GENE-000128-11 Length:322 Species:Danio rerio


Alignment Length:274 Identity:68/274 - (24%)
Similarity:99/274 - (36%) Gaps:74/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 VLPSALHHPQPHP-------------------PTHPH---------THPHALMH-----PHGKLG 173
            :|||.:..|..:|                   .||..         :.|.|.||     |...  
Zfish     2 MLPSVIAPPAMYPSFLRPSSALSLPPALQSAFTTHSSFLVEDLLRISRPAAFMHRSIPSPSAS-- 64

  Fly   174 HFPPTAGGNGLNVAQYAAAMQQHYAAAAAAAAARNNAAAAAAA-----------AAAAAAAGVAA 227
              ||..|...||....|.     :.|.:.|.|.|:::...:.:           |..|:....|:
Zfish    65 --PPATGVTTLNTTSSAV-----HVAMSTALAKRSSSPQTSISSDPNYLKFGVNAILASTTRNAS 122

  Fly   228 PPVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKSGSTSDM 292
            ||            ||..|....:..:     .|..|:.......|..........:.......:
Zfish   123 PP------------PPVQGMNAKTFPF-----PCFDGSFHPFIRASYFPASSSAVPIPGTFAWPL 170

  Fly   293 SGLSKKQR--KARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWK 355
            :...|.:|  ..|..|:|.|.:.|||.|::|||:|..:|::||.||.|.|.|||.|:||||.||:
Zfish   171 TARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLATKLGLKDSQVKIWFQNRRMKWR 235

  Fly   356 RQTAVGLELLAEAG 369
            ....  .|||:..|
Zfish   236 NSKE--RELLSSGG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 28/51 (55%)
dbx1bNP_571253.1 COG5576 <173..296 CDD:227863 35/77 (45%)
Homeobox 182..235 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..266 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.