DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and hoxc6a

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_571198.1 Gene:hoxc6a / 30346 ZFINID:ZDB-GENE-990415-113 Length:231 Species:Danio rerio


Alignment Length:91 Identity:31/91 - (34%)
Similarity:52/91 - (57%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 GGKDDDGNSV-------KSGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQEL 332
            |.:|...|::       :..|.|.: |....:|:.|..::.:|...|||.|...:||:.:.|.|:
Zfish   112 GTQDQKANNIQIYPWMQRMNSHSGV-GYGSDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEI 175

  Fly   333 AHKLDLSDCQVKTWYQNRRTKWKRQT 358
            |:.|.|::.|:|.|:||||.|||::|
Zfish   176 ANALCLTERQIKIWFQNRRMKWKKET 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 23/55 (42%)
hoxc6aNP_571198.1 Antp-type hexapeptide 123..128 0/4 (0%)
Homeodomain 143..199 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 1/2 (50%)

Return to query results.
Submit another query.