DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Tlx3

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_036012630.1 Gene:Tlx3 / 27140 MGIID:1351209 Length:338 Species:Mus musculus


Alignment Length:285 Identity:76/285 - (26%)
Similarity:102/285 - (35%) Gaps:93/285 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 NGDNCEASNVAGVGVLPSALHHPQPHPPTHPHTHPH-------ALMHPHGKLG------------ 173
            |||             |:|    .|..|..|...|.       ...|||..:.            
Mouse    29 NGD-------------PAA----SPPSPAQPFRPPRMEAPASAQTPHPHEPISFGIDQILNSPDQ 76

  Fly   174 -HFPPTAGGNGLNVAQY---------AAAMQQHYAAAAAAAAARNNAAAAAAAAAAAAAAGVAAP 228
             ..|...|.:|   |.|         .||.....|:.|...|...:|.:.:...:.|.|..:..|
Mouse    77 DSAPAPRGPDG---ASYLGGPPGGRPGAAYPSLPASFAGLGAPFEDAGSYSVNLSLAPAGVIRVP 138

  Fly   229 ---PVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMDDHSVCSNGG-----KDDDGNSVK 285
               |:.|.|...:..|.||...:.                    :|.|.||     .:.....||
Mouse   139 AHRPLPGAVPPPLPSALPAMPSVP--------------------TVSSLGGLNFPWMESSRRFVK 183

  Fly   286 SGSTSD----------------MSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAH 334
            ...|:.                .:....|::|.||:|:..|:..|||.|.|||||:..||..||.
Mouse   184 DRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAK 248

  Fly   335 KLDLSDCQVKTWYQNRRTKWKRQTA 359
            .|.::|.|||||:|||||||:||||
Mouse   249 SLKMTDAQVKTWFQNRRTKWRRQTA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 30/51 (59%)
Tlx3XP_036012630.1 PRK07764 <20..>109 CDD:236090 19/99 (19%)
Homeobox 216..270 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.