DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Obox6

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_663756.2 Gene:Obox6 / 252830 MGIID:2149036 Length:347 Species:Mus musculus


Alignment Length:204 Identity:50/204 - (24%)
Similarity:86/204 - (42%) Gaps:55/204 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 GNSVKSGSTSD--MSGLS-KKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQ 342
            |..|:|.|..|  :|.:: :|.||.||.:|:.|...|:|.|.:..|.|.::|..||..:.::..:
Mouse   124 GPMVRSPSYGDRRVSLVTPRKHRKIRTVYTEEQKCVLKKHFHKCTYPSREQRMALAVLVGVTANE 188

  Fly   343 VKTWYQNRRTKWKRQTAVGL-----------ELLAEAGNF---------AAFQRLYGGS------ 381
            ::.|::|.|.|.||::...:           |.::|:.:|         |..:.::.|:      
Mouse   189 IQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSESVHFPDSLPVVASANGESMWSGTFGEDSI 253

  Fly   382 PYLGAWPYAAAAGAAHGATPHTNIDIYYRQAAAAAAMQKPLPYNLYAGVP----------SVGVG 436
            |.|. |       :...:.||      |:  |..:|...|..|.|....|          :|.|.
Mouse   254 PNLN-W-------SQESSPPH------YQ--ACDSARYCPQEYLLNGHAPVTAWNSGQSVAVEVQ 302

  Fly   437 VGVGVGPAP 445
            .|:.|..||
Mouse   303 TGLAVAEAP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 16/51 (31%)
Obox6NP_663756.2 COG5576 86..>204 CDD:227863 27/79 (34%)
homeodomain 146..204 CDD:238039 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.