DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Bsx

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_839976.1 Gene:Bsx / 244813 MGIID:2669849 Length:232 Species:Mus musculus


Alignment Length:68 Identity:39/68 - (57%)
Similarity:49/68 - (72%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 SDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKW 354
            :::.|...::|||||.|:|.||..|||.||.|:|||..||.|||..|.||:.|||||:||||.|.
Mouse   101 AELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKH 165

  Fly   355 KRQ 357
            |:|
Mouse   166 KKQ 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 36/55 (65%)
BsxNP_839976.1 Homeodomain 111..167 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..232 6/9 (67%)

Return to query results.
Submit another query.