DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Dbx2

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_997416.2 Gene:Dbx2 / 223843 MGIID:107445 Length:377 Species:Mus musculus


Alignment Length:67 Identity:28/67 - (41%)
Similarity:44/67 - (65%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 TSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTK 353
            |.|.:..:::....|..|::.|.:.|||.|::|||:|..:|::||..|.|.:.|||.|:||||.|
Mouse   216 TQDSNSKARRGILRRAVFSEEQRKALEKMFQKQKYISKTDRRKLAVSLGLKESQVKIWFQNRRMK 280

  Fly   354 WK 355
            |:
Mouse   281 WR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 25/51 (49%)
Dbx2NP_997416.2 COG5576 <217..334 CDD:227863 27/66 (41%)
Homeobox 229..282 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.