DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Tlx2

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_033418.1 Gene:Tlx2 / 21909 MGIID:1350935 Length:284 Species:Mus musculus


Alignment Length:251 Identity:72/251 - (28%)
Similarity:101/251 - (40%) Gaps:77/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 ALHHPQPHPPTHPHTHPHALMHPHGKLGHFPPTAGGNGLNVAQYAAAMQQHYAAAAAAAAARNNA 210
            |.||       .||..|.:........|..||   |.||...|..    |.:..:||.::..:.|
Mouse     7 AAHH-------LPHHEPISFGIDQILSGPEPP---GGGLGPGQSG----QSHGESAAFSSGFHGA 57

  Fly   211 AAAAAAAAAAA---AAGV---------------------AAPPVDG--GVDGGVGLAPPAGGDLD 249
            :..|.|.:.|:   .:||                     |||.|.|  |:.|..|||......:|
Mouse    58 SGYAPAGSLASLPRGSGVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAGGLAGLTFPWMD 122

  Fly   250 DSSDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKSGSTSDMSGLSK-----------KQRKAR 303
            ....:.::.                          .:.:.|..||..:           |::|.|
Mouse   123 SGRRFAKDR--------------------------LTAALSPFSGTRRIGHPYQNRTPPKRKKPR 161

  Fly   304 TAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTA 359
            |:|:..|:..||:.|.|||||:..||..||..|.::|.|||||:|||||||:||||
Mouse   162 TSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 29/51 (57%)
Tlx2NP_033418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..52 10/38 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..104 4/25 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..166 7/25 (28%)
Homeobox 160..213 CDD:306543 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.