DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and ceh-30

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_508524.2 Gene:ceh-30 / 191620 WormBaseID:WBGene00000451 Length:237 Species:Caenorhabditis elegans


Alignment Length:224 Identity:82/224 - (36%)
Similarity:111/224 - (49%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 SDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKS----GSTSDMSGLSKKQRKARTAFTDHQLQ 312
            ||..|::.: :|.:.:||.......|.|...|.::    |......|..||.|||||.|||.|||
 Worm    45 SDILEQSPN-NSSHSNDHDPSPQSIKSDFSTSPRASSPGGDRMGSPGSCKKSRKARTIFTDKQLQ 108

  Fly   313 TLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGNFAAFQRL 377
            .||.:||:|||||||:|.:|||::.|:|.||||||||||||||||...|::||:|.||.:|.|.|
 Worm   109 ELENTFEKQKYLSVQDRMDLAHRMGLTDTQVKTWYQNRRTKWKRQATSGMDLLSEPGNLSAVQNL 173

  Fly   378 YGGSPYLGAWPYAAAAGAAHGATPHTNIDIYYRQAAAAAAMQKPLPYNLYAGVPSVGVGVGVGVG 442
            ...|||...:..|...|..                                 :|.:|:.:.:.|.
 Worm   174 IRSSPYWANYITALPMGTQ---------------------------------LPMMGLPMSMIVP 205

  Fly   443 PA-----------PFSHLSASSSLSSLSS 460
            ||           |.:|:|:.|....:||
 Worm   206 PAHAFQPSSSSNSPSTHISSESPQLDVSS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 37/51 (73%)
ceh-30NP_508524.2 Homeobox 99..151 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167948
Domainoid 1 1.000 97 1.000 Domainoid score I4537
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002353
OrthoInspector 1 1.000 - - mtm4821
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24330
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10747
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.