DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and DLX5

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_005212.1 Gene:DLX5 / 1749 HGNCID:2918 Length:289 Species:Homo sapiens


Alignment Length:135 Identity:33/135 - (24%)
Similarity:51/135 - (37%) Gaps:37/135 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NKIYHPNIDEVSG------TVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNGDA---- 126
            |.:.:..|....|      .||:..|.......|.|.|:|.:.         .||.| .||    
Human   764 NSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAI---------AVDNL-ADAESLT 818

  Fly   127 AAMYLHKPEEYRKKVA---------DYVRRYATEEALREQDPTES--SDSES------SMSDFSE 174
            :|....:.|:.|||:|         :.:.:.|.||:..|:...:|  :|.||      :|.|...
Human   819 SAQKEEEEEKERKKLARTASPEKKQEVMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQP 883

  Fly   175 DEAQD 179
            .|.:|
Human   884 SENED 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649
DLX5NP_005212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
DLL_N 32..118 CDD:463567
Homeodomain 138..194 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..251
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.