DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Hoxa7

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001406200.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:270 Species:Mus musculus


Alignment Length:94 Identity:31/94 - (32%)
Similarity:51/94 - (54%) Gaps:10/94 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 GNMDDHSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQE 328
            |::..|  |:.|...   |..::..|.     ...:::.|..:|.:|...|||.|...:||:.:.
Mouse   145 GSLTHH--CTRGHFQ---NGAEANGTE-----GPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRR 199

  Fly   329 RQELAHKLDLSDCQVKTWYQNRRTKWKRQ 357
            |.|:||.|.|::.|:|.|:||||.|||::
Mouse   200 RIEIAHALCLTERQIKIWFQNRRMKWKKE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 24/55 (44%)
Hoxa7NP_001406200.1 Homeodomain 171..227 CDD:459649 24/55 (44%)

Return to query results.
Submit another query.