DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Dlx4

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_031893.3 Gene:Dlx4 / 13394 MGIID:94904 Length:240 Species:Mus musculus


Alignment Length:67 Identity:29/67 - (43%)
Similarity:46/67 - (68%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 SDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKW 354
            |....|::|.||.||.::..|||.|.:.|:..:||::.||.:||.:|.|:..|||.|:||:|:|:
Mouse   107 SQQQSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKY 171

  Fly   355 KR 356
            |:
Mouse   172 KK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 25/55 (45%)
Dlx4NP_031893.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70
Homeodomain 117..173 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..194
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.