DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Dbx1

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001005232.1 Gene:Dbx1 / 13172 MGIID:94867 Length:335 Species:Mus musculus


Alignment Length:255 Identity:62/255 - (24%)
Similarity:87/255 - (34%) Gaps:100/255 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 GLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQT 358
            |..::....|..|:|.|.:.|||:|::|||:|..:|::||.||.|.|.|||.|:||||.||:...
Mouse   176 GKPRRGMLRRAVFSDVQRKALEKTFQKQKYISKPDRKKLASKLGLKDSQVKIWFQNRRMKWRNSK 240

  Fly   359 AVGLELLAEAGNFAAFQRLYGGSPYLGAWPYAAAAGAAHGATPHTNIDIYYRQAAAAAAMQKPLP 423
            .  .|||:..|                                               ..::.||
Mouse   241 E--RELLSSGG-----------------------------------------------CREQTLP 256

  Fly   424 YNLYAGVPSVGVGVGVGVGPAPFSHLSASSSLSSLSSYYQSAAAAASAANPGGP---HPVAPPPS 485
            ..|               .|.|           .||...|.........|||..   |..|.|..
Mouse   257 TKL---------------NPHP-----------DLSDVGQKGPGDEEEDNPGARLAYHAPADPRH 295

  Fly   486 VGGGSPPSGLVKPIPAHSASASPPPRPPSTPSPTLNPGSPPGRS-VDSCSQSDDEDQIQV 544
            :..|..|:.     ||||:|                ||.|...| .|...:.:::::|.|
Mouse   296 LLEGPLPAS-----PAHSSS----------------PGKPSDFSDSDEDEEGEEDEEITV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 28/51 (55%)
Dbx1NP_001005232.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..102
Homeobox 184..237 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..335 32/191 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.