DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Cdx4

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_031700.1 Gene:Cdx4 / 12592 MGIID:88362 Length:282 Species:Mus musculus


Alignment Length:36 Identity:8/36 - (22%)
Similarity:17/36 - (47%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSPSAGKRRMDTDVIKLIESKHEVTILGGLNEFCV 36
            |::|.:....:....:|:..|:..||.:...|:..|
Mouse     1 MATPYSRPPPLHITCVKVHSSQKAVTFIKHENKIIV 36

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649
Cdx4NP_031700.1 Caudal_act 13..168 CDD:461413 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..36 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..156
Homeodomain 173..228 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.