| Sequence 1: | NP_523387.1 | Gene: | B-H1 / 32724 | FlyBaseID: | FBgn0011758 | Length: | 544 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_031700.1 | Gene: | Cdx4 / 12592 | MGIID: | 88362 | Length: | 282 | Species: | Mus musculus |
| Alignment Length: | 36 | Identity: | 8/36 - (22%) |
|---|---|---|---|
| Similarity: | 17/36 - (47%) | Gaps: | 0/36 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MSSPSAGKRRMDTDVIKLIESKHEVTILGGLNEFCV 36 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| B-H1 | NP_523387.1 | Homeodomain | 300..356 | CDD:459649 | |
| Cdx4 | NP_031700.1 | Caudal_act | 13..168 | CDD:461413 | 6/24 (25%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 13..36 | 5/22 (23%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 98..156 | ||||
| Homeodomain | 173..228 | CDD:459649 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||