DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and DBX1

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001025036.2 Gene:DBX1 / 120237 HGNCID:33185 Length:343 Species:Homo sapiens


Alignment Length:260 Identity:66/260 - (25%)
Similarity:91/260 - (35%) Gaps:104/260 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 GLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQT 358
            |..::....|..|:|.|.:.|||.|::|||:|..:|::||.||.|.|.|||.|:||||.||:...
Human   176 GKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQVKIWFQNRRMKWRNSK 240

  Fly   359 AVGLELLAEAGNFAAFQRLYGGSPYLGAWPYAAAAGAAHGATPHTNIDIYYRQAAAAAAMQKPLP 423
            .  .|||:..|                                               ..::.||
Human   241 E--RELLSSGG-----------------------------------------------CREQTLP 256

  Fly   424 YNLYAGVPSVGVGVGVGVGPAPFSHLSASSSLSSLSSYYQSAAAAASAANPGGPHPVAPPPSVGG 488
            ..|               .|.|           .||...|.        .||...     ...|.
Human   257 TKL---------------NPHP-----------DLSDVGQK--------GPGNEE-----EEEGP 282

  Fly   489 GSPPSGLVKPIPAHSASASPP---------PRPPSTPSPTLNPGSPPGRSVDSCSQSDDEDQIQV 544
            |||...|     |:.||:.|.         |.||| |:.:.:||.|...| ||..:.:.|:|.::
Human   283 GSPSHRL-----AYHASSDPQHLRDPRLPGPLPPS-PAHSSSPGKPSDFS-DSEEEEEGEEQEEI 340

  Fly   545  544
            Human   341  340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 28/51 (55%)
DBX1NP_001025036.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..100
Homeobox 184..237 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..343 36/196 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.