DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and dbx1

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_002940015.1 Gene:dbx1 / 100495433 XenbaseID:XB-GENE-480177 Length:328 Species:Xenopus tropicalis


Alignment Length:330 Identity:72/330 - (21%)
Similarity:113/330 - (34%) Gaps:98/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LQPPAV-AHSIHSTTTMSSGGSTTTASGIGKPNRSRFMINDILAGSAAAAFYKQQQHHQQLHHHN 105
            |.|||| .:.:..|.|::...|..||..    :.:.|:|.|::..|..|.|..:......:....
 Frog     7 LAPPAVYPNLLRPTPTLTLPQSIQTALS----SHTSFLIEDLIRISRPAGFLPRAVPPPSMSPPT 67

  Fly   106 NNNNSGSSGGSSPAHSNNNNNINGDNCEASNVAGVGVLPSALHHPQPHPPTHPH-THPHALMHPH 169
            :::.:..|.....|......:|:.:|.......||..:.||....:..|...|. ..|.|...|:
 Frog    68 SDSPTSLSEVPDLARREAPTSISSNNSSTFLKFGVNAILSASPRTETCPALPPSVAPPKAFAFPY 132

  Fly   170 GKLGHFPPTAGGNGLNVAQYAAAMQQHYAAAAAAAAARNNAAAAAAAAAAAAAAGVAAPPVDGGV 234
            .: |.|.|              .::..|..|:::..                       |:.|..
 Frog   133 FE-GSFQP--------------FIRSSYFPASSSVV-----------------------PIPGTF 159

  Fly   235 DGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQ 299
            ..     |.|.                                               .|..::.
 Frog   160 SW-----PLAA-----------------------------------------------RGKPRRG 172

  Fly   300 RKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTAVGLEL 364
            ...|..|:|.|.:.|||.|::|||:|..:|::||.||.|.|.|||.|:||||.||:....  .||
 Frog   173 MLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAGKLGLKDSQVKIWFQNRRMKWRNSKE--REL 235

  Fly   365 LAEAG 369
            |:..|
 Frog   236 LSSGG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 28/51 (55%)
dbx1XP_002940015.1 Homeobox 175..229 CDD:365835 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.