DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and barhl1

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_004916717.1 Gene:barhl1 / 100491447 XenbaseID:XB-GENE-853661 Length:327 Species:Xenopus tropicalis


Alignment Length:288 Identity:110/288 - (38%)
Similarity:140/288 - (48%) Gaps:45/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PPT---------AGGNGLNVAQYAAAMQQHYAAAAAAAAARNNAAAAAA-----AAAAAAAAGVA 226
            ||:         ||..|:     |.||:.|.......:|...:....::     ..|........
 Frog    51 PPSPDRDCLDGVAGRQGV-----ALAMESHLQPGVQLSAPSQSRTVTSSFLIRDILADCKPLATC 110

  Fly   227 APPVDGGV---DGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKSGS 288
            ||....|.   |....||..|..|..|..|....:...:|.        ..|...::|:...|.|
 Frog   111 APYSSNGQPTHDLAHCLASKAADDFRDKLDKSSSSTSSESE--------YKGKVKEEGDREISSS 167

  Fly   289 TSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTK 353
            ........||.||||||||||||..||:|||||||||||:|.|||..|:|:|.||||||||||||
 Frog   168 RDSPPVRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTK 232

  Fly   354 WKRQTAVGLELLAEAGNFAAFQRLYGGSPYLGAWPYAAAAGAAHGATPHTNIDIYYRQAAAAAAM 418
            |||||||||||||||||::|.||:: .|||.  :|.:..:....||.    :.:|....|...|:
 Frog   233 WKRQTAVGLELLAEAGNYSALQRMF-PSPYF--YPQSLVSNLDPGAA----LYLYRGPTAPPPAL 290

  Fly   419 QKPLPYNLYAGVPSVGV-GVGVGVGPAP 445
            |:||       ||.:.: |:..|..|.|
 Frog   291 QRPL-------VPRILIHGLQGGSEPPP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 41/51 (80%)
barhl1XP_004916717.1 Homeobox 182..235 CDD:365835 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6703
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I3849
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002353
OrthoInspector 1 1.000 - - mtm9355
Panther 1 1.100 - - LDO PTHR24330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.