DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and hoxc12

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_002936693.1 Gene:hoxc12 / 100487557 XenbaseID:XB-GENE-853677 Length:263 Species:Xenopus tropicalis


Alignment Length:115 Identity:38/115 - (33%)
Similarity:60/115 - (52%) Gaps:4/115 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 PPAGGDLDDSSDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQRKARTAF 306
            ||:...|:..|.....||...:...:..::.|   ..:.|||:.: |.:....:..:.||.|..:
 Frog   142 PPSCQSLESDSGSSLLNEGTKNAVSEAATMAS---PSNPGNSLPA-SGAPWYPIHTRSRKKRKPY 202

  Fly   307 TDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKR 356
            :..||..||..|...::::.|.|:||:.:|.|||.|||.|:||||.|.||
 Frog   203 SKIQLAELEGEFMVNEFITRQRRRELSDRLSLSDQQVKIWFQNRRMKKKR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 25/55 (45%)
hoxc12XP_002936693.1 Homeodomain 196..252 CDD:459649 25/55 (45%)

Return to query results.
Submit another query.