DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and barx2

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_001342044.1 Gene:barx2 / 100002200 ZFINID:ZDB-GENE-081120-4 Length:268 Species:Danio rerio


Alignment Length:80 Identity:41/80 - (51%)
Similarity:52/80 - (65%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 SVKSGS-TSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTW 346
            |:.|.| |...:...||.|::||.||:.||..|||.|::|||||..:|.:||..|.|:..|||||
Zfish   102 SISSESDTEHCTPRLKKPRRSRTIFTELQLLGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTW 166

  Fly   347 YQNRRTKWKRQTAVG 361
            |||||.|||:....|
Zfish   167 YQNRRMKWKKMVLKG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 31/51 (61%)
barx2XP_001342044.1 Homeobox 122..175 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575735
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.