DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and BARX2

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_003649.2 Gene:BARX2 / 8538 HGNCID:956 Length:279 Species:Homo sapiens


Alignment Length:186 Identity:59/186 - (31%)
Similarity:83/186 - (44%) Gaps:40/186 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 ANGDSSSHLSLSLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWY 428
            |:.:|.:.......||.|::||.||:.||..|||.|::|||||..||::||..|.|:..||||||
Human   117 ASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWY 181

  Fly   429 QNRRTKWKRQTAVGLELLAEAGNYAAFQRLYGGATPYLSAWPYAAAAAAQSPHG-----ATPSAI 488
            ||||.|||:..                  |.||            ..|...|.|     :.|::.
Human   182 QNRRMKWKKMV------------------LKGG------------QEAPTKPKGRPKKNSIPTSE 216

  Fly   489 DIYYRQAAAAAAMQKPSLPASY---RMYQSSIPPGMSLP-GMPAPP-PPGAAPMLS 539
            :|...:...:.|..:..|..|.   .:.::..|....:| .|..|| ||...|:.|
Human   217 EIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDPPQELPIPS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 32/51 (63%)
BARX2NP_003649.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..137 5/19 (26%)
Homeobox 136..189 CDD:306543 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..279 19/91 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142898
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.