DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and NKX6-2

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_796374.2 Gene:NKX6-2 / 84504 HGNCID:19321 Length:277 Species:Homo sapiens


Alignment Length:63 Identity:29/63 - (46%)
Similarity:45/63 - (71%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 KQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTAV 441
            |::.:|..|:..|:..|||:||:.|||:..:|..||..|.:::.|||.|:|||||||:::.||
Human   147 KKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 26/55 (47%)
NKX6-2NP_796374.2 Repressor domain. /evidence=ECO:0000250|UniProtKB:D3Z4R4 89..142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..155 2/7 (29%)
Homeodomain 147..205 CDD:459649 27/57 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 29/63 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.