DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and HB22

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_850266.1 Gene:HB22 / 818233 AraportID:AT2G36610 Length:185 Species:Arabidopsis thaliana


Alignment Length:168 Identity:47/168 - (27%)
Similarity:73/168 - (43%) Gaps:48/168 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 NSNIISGNSSSS------NNNNGSGN-GNMLLG---GPGSSISGDQASTIDDSDSDDCGGKDDDG 354
            :|:.|.|.||||      |.::.||| .|..||   |....|.....:.::..          .|
plant     5 SSSFIDGASSSSFISPFYNFDHFSGNQDNRCLGTMMGAQQDILHVPLAMVESG----------YG 59

  Fly   355 DDSMKNGSSANGDSSSHLSLSLSKKQRKARTAFTDHQLQTLEKSF--------ERQKYLSVQDRM 411
            ::|    :|.||             |.|.:...|..||:.||:||        :|:..|:...:|
plant    60 EES----NSFNG-------------QEKKKKKMTSEQLKFLERSFQEEIKLNPDRKMKLNPDRKM 107

  Fly   412 ELANKLELSDCQVKTWYQNRRTKWKRQTAVGLELLAEA 449
            :|:.:|.|...|:..|:|||:.:||.:.   ||.|.|:
plant   108 KLSKELGLQPRQIAVWFQNRKARWKNKQ---LEHLYES 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 20/63 (32%)
HB22NP_850266.1 Homeodomain 70..133 CDD:459649 20/62 (32%)
HALZ 134..167 CDD:460477 4/12 (33%)

Return to query results.
Submit another query.