DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and vox

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_571773.1 Gene:vox / 64807 ZFINID:ZDB-GENE-010108-1 Length:242 Species:Danio rerio


Alignment Length:144 Identity:42/144 - (29%)
Similarity:69/144 - (47%) Gaps:33/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 NSASANSNIISGNSSSSNNNNGSGNGNMLLGGPGSSISGDQASTIDDSDSDDCGGKDDDGDDSMK 359
            :|....:.:...|.||.:.:..||..:    |..|..:..:.:::            :||.|:.|
Zfish    65 SSKETPAQVTPRNCSSPSFSENSGYSS----GYESEAAASECASV------------EDGHDAEK 113

  Fly   360 NGSSANGDSSSHLSLSLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQV 424
            :|::                 |:.||.||..|:..|||.|.:.|||...:|::.|.||.||:.|:
Zfish   114 DGAT-----------------RRIRTKFTPEQIDKLEKIFNKHKYLDAGERVKTALKLGLSETQI 161

  Fly   425 KTWYQNRRTKWKRQ 438
            :||:||||.|.||:
Zfish   162 RTWFQNRRMKLKRE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 26/51 (51%)
voxNP_571773.1 COG5576 75..>187 CDD:227863 41/134 (31%)
Homeobox 121..173 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.