DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and bsx

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_999892.1 Gene:bsx / 573364 ZFINID:ZDB-GENE-040628-4 Length:227 Species:Danio rerio


Alignment Length:60 Identity:37/60 - (61%)
Similarity:46/60 - (76%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 KQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQ 438
            ::|||||.|:|.||..|||.||.|:|||..:|:|||..|.||:.|||||:||||.|.|:|
Zfish   104 RRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 35/55 (64%)
bsxNP_999892.1 Homeodomain 106..162 CDD:459649 35/55 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..227 4/7 (57%)

Return to query results.
Submit another query.