DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and BARX1

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_067545.3 Gene:BARX1 / 56033 HGNCID:955 Length:254 Species:Homo sapiens


Alignment Length:84 Identity:43/84 - (51%)
Similarity:51/84 - (60%) Gaps:17/84 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 HLSLSL-----------------SKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLE 418
            ||.|.|                 :||.|::||.||:.||..|||.||:|||||..||::||..|.
Human   116 HLPLELQLRGKLEAAGPGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLG 180

  Fly   419 LSDCQVKTWYQNRRTKWKR 437
            ||..||||||||||.|||:
Human   181 LSQLQVKTWYQNRRMKWKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 34/51 (67%)
BARX1NP_067545.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Homeobox 145..199 CDD:395001 35/53 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.