DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and barhl1a

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001017712.2 Gene:barhl1a / 550407 ZFINID:ZDB-GENE-050417-212 Length:299 Species:Danio rerio


Alignment Length:217 Identity:96/217 - (44%)
Similarity:115/217 - (52%) Gaps:57/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 SISGDQASTIDDSDSDDCGGK-----DDDGDDSMKNGSSANGDSSSHLSLSLSKKQRKARTAFTD 389
            |.:|..|     .|::||..|     ..|.:..:|:.:.....||.....|..||.|||||||||
Zfish   105 SSTGQSA-----QDAEDCMDKLHSNSSSDSEYRVKDEADREISSSRDSPNSRLKKPRKARTAFTD 164

  Fly   390 HQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGNYAA 454
            |||..||:|||||||||||||||||..|.|:|.||||||||||||||||||||||||||||||:|
Zfish   165 HQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSA 229

  Fly   455 FQRLYGGATPYLSAWPYAAAAAAQSPHGATPSAIDIYYRQAAAAAAMQKPSLPASYRMYQSSIPP 519
            .||::  .:||                         :|.|:..                 |::.|
Zfish   230 LQRMF--PSPY-------------------------FYPQSLV-----------------SNLDP 250

  Fly   520 GMSL---PGMPAPPPPGAAPML 538
            |..|   .|..|||||...|::
Zfish   251 GPGLYLYRGPSAPPPPVQRPLV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 43/51 (84%)
barhl1aNP_001017712.2 TPP_enzymes <122..177 CDD:294952 24/54 (44%)
Homeobox 159..211 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575740
Domainoid 1 1.000 103 1.000 Domainoid score I6717
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4314
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002353
OrthoInspector 1 1.000 - - mtm6505
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10747
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.