DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and mnx2a

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001009886.2 Gene:mnx2a / 406205 ZFINID:ZDB-GENE-040415-1 Length:309 Species:Danio rerio


Alignment Length:71 Identity:36/71 - (50%)
Similarity:42/71 - (59%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 DSSSHLSLSLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNR 431
            |.|......|..|.|:.|||||..||..||..|:..||||...|.|:|..|.|::.|||.|:|||
Zfish   137 DYSGAPQSGLIGKCRRPRTAFTSQQLLELENQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNR 201

  Fly   432 RTKWKR 437
            |.||||
Zfish   202 RMKWKR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 30/55 (55%)
mnx2aNP_001009886.2 Homeodomain 151..207 CDD:459649 30/55 (55%)

Return to query results.
Submit another query.