DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and NKX1-2

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001139812.1 Gene:NKX1-2 / 390010 HGNCID:31652 Length:310 Species:Homo sapiens


Alignment Length:264 Identity:75/264 - (28%)
Similarity:109/264 - (41%) Gaps:77/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 GPGSSISGDQASTIDDSDSDDCGGKDDDGDDSMK---------------------NGSSANGDSS 369
            |||:.    |||.::.|::::    ::|.:|..:                     .|:.|:|:..
Human    75 GPGAG----QASPLEGSEAEE----EEDAEDPRRPRLRERAARLLPGLARSPDAPAGALASGEPC 131

  Fly   370 S----------------------HLSLSLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRME 412
            .                      .|..:.: |.|:||||||..||..||..|...:||||.:|:.
Human   132 EDGGGGPVRSPPGSPGSPRPRRRRLEPNCA-KPRRARTAFTYEQLVALENKFRATRYLSVCERLN 195

  Fly   413 LANKLELSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGNYAAFQRLYGGATPYLSAWPYAAAAAA 477
            ||..|.|::.|||.|:||||||||:|.. |.:..|:.|         |||..     |.||....
Human   196 LALSLSLTETQVKIWFQNRRTKWKKQNP-GADGAAQVG---------GGAPQ-----PGAAGGGG 245

  Fly   478 QSPHGATPSAIDIYYRQAAAAAAMQK-PSLPASYRMYQS--SIPPGMSLPGMPAPPPPGAAPMLS 539
            ....|.:|..      ....|...|. ||..|:..::.|  |.|...:.||.|..|..|.: .|:
Human   246 GGGSGGSPGP------PGTGALHFQTFPSYSAANVLFPSAASFPLTAAAPGSPFAPFLGPS-YLT 303

  Fly   540 GYYA 543
            .:||
Human   304 PFYA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 29/51 (57%)
NKX1-2NP_001139812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..165 14/98 (14%)
Homeobox 167..219 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..260 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.