DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and CG34031

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster


Alignment Length:190 Identity:57/190 - (30%)
Similarity:83/190 - (43%) Gaps:48/190 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 SASNNNNNNNNSASANSNIISGNSS---------SSNNNNGSGNGNMLLGGP--------GSSIS 332
            |.|..:::.|:....|:|:.|.:.|         ..||.....|.::..|.|        ||::|
  Fly    38 STSEAHSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVS 102

  Fly   333 GDQASTIDDSDSDDCGGKDDDGDDSMKNGSSANGDSSSHLSLSLSKKQ-------RKARTAFTDH 390
            .....|                 :|:......|       |.:|.:||       ||.|.|::..
  Fly   103 RFVWRT-----------------ESILPSYITN-------STNLQEKQLRKRFTDRKPRQAYSAS 143

  Fly   391 QLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTAVGLELLAEAG 450
            ||:.||..|...|||||..|:||:..|.|::.|||||:||||||||:|....|::....|
  Fly   144 QLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKIAHRHG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 28/51 (55%)
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.