DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and ved

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_898897.1 Gene:ved / 368201 ZFINID:ZDB-GENE-030813-1 Length:278 Species:Danio rerio


Alignment Length:225 Identity:63/225 - (28%)
Similarity:97/225 - (43%) Gaps:47/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 SASANSNIISGNSSSSNNNNGSGNGNMLLGGPGSSISGDQASTIDDSDSDDCGGKDDDGDDSMKN 360
            |:|.....:||..|..:.:.|||:.:....|..:..||                          :
Zfish    96 SSSTEDEELSGCESEGSRSEGSGSRSPAAPGSVAPASG--------------------------S 134

  Fly   361 GSSANGDSSSHLSLSLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVK 425
            ||.::|              |:.||||:..|:.:||:.|:|..||..||:.||...|:|:|.|::
Zfish   135 GSPSSG--------------RRPRTAFSSEQISSLERVFKRNAYLGAQDKAELCRTLKLTDKQIR 185

  Fly   426 TWYQNRRTKWKRQTAVGLELLAE---AGNYAAFQRLYG-GATPYLSAWPYAAAAAAQSPHGATPS 486
            .|:||||.|.||.....|....:   |.:...:..|:. .|.||.|.:|...||.| .|:..:|:
Zfish   186 NWFQNRRMKLKRTVQDSLAQACQVKVASHMMHYSDLHSFRAAPYPSFYPETPAAFA-PPYPISPA 249

  Fly   487 AIDIYYRQAAAAAAMQKPSLPASYRMYQSS 516
            |..:||........:  ||:|.....|.|:
Zfish   250 AESLYYSSYQNLQGV--PSIPVHPYQYYST 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 25/51 (49%)
vedNP_898897.1 Homeobox 145..196 CDD:278475 24/50 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.