DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and pnx

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_840087.1 Gene:pnx / 352939 ZFINID:ZDB-GENE-030328-42 Length:182 Species:Danio rerio


Alignment Length:85 Identity:39/85 - (45%)
Similarity:57/85 - (67%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 DSMKNGSSANGDSSSHL-SLSLSK-KQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLE 418
            :|.|..|.....|:.:: :.|.:| |.::.|||||..||:.||:||:...||||.:|..:|:.|.
Zfish    41 ESPKTTSPTQEPSAPNIANASAAKVKSKRIRTAFTLDQLRILERSFQSSHYLSVFERHCIASALG 105

  Fly   419 LSDCQVKTWYQNRRTKWKRQ 438
            ||:.|||.|:||||||||::
Zfish   106 LSETQVKIWFQNRRTKWKKE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 31/55 (56%)
pnxNP_840087.1 Important for interaction with tle3a. /evidence=ECO:0000269|PubMed:12642490 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 5/21 (24%)
Homeodomain 68..124 CDD:459649 31/55 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.