DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and H2.0

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster


Alignment Length:64 Identity:16/64 - (25%)
Similarity:26/64 - (40%) Gaps:14/64 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SLSVLQCLSSCLHNKYSEGLPGQRYYGGNEFIDQIELLAQKRA-LEAYRLSPEEWGCNVQPYSG 106
            :|..::.:.||.|             .|.|||.:..|.|.... .|.||.:.:..|.:.:.:||
  Fly   434 ALGKVKPIYSCEH-------------CGREFIRKSNLKAHAYIHEEVYRFACDLCGQSFKQHSG 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649
H2.0NP_523488.2 Homeodomain 292..352 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.