DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and HOXD4

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens


Alignment Length:57 Identity:27/57 - (47%)
Similarity:42/57 - (73%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 RKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKR 437
            :::|||:|..|:..|||.|...:||:.:.|:|:|:.|.||:.|:|.|:||||.|||:
Human   155 KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 26/55 (47%)
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127
Antp-type hexapeptide 133..138
Homeodomain 155..211 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 27/57 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.