DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and CG11085

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster


Alignment Length:282 Identity:93/282 - (32%)
Similarity:119/282 - (42%) Gaps:76/282 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSHQQHHPHLHHPMHDERSRSPLMLQQLGGNGGNNNNNNNNSSSASNNNNNNNNSASANSNIISG 306
            |||  ||....|  |||.|....:....|                                  .|
  Fly    56 LSH--HHRRFTH--HDESSVESCLSATRG----------------------------------PG 82

  Fly   307 NSSSSNNNNGSGNGNMLLGGPGSSIS------GDQASTIDDSDSDDCGGKDDDGDDSMKNGSSAN 365
            :.:.|....|.|.|    ||..|.:|      |..|..:..:.|...|.:|.:|.....:|...:
  Fly    83 SGTGSGGGGGGGGG----GGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTS 143

  Fly   366 GDSSSH-LSLSLS-KKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWY 428
            |..:.| |.||.| :|.|:.|||||..||..||:.|..||||||.||.::|..|.||:.||||||
  Fly   144 GGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWY 208

  Fly   429 QNRRTKWKRQTAVGLELLAEAGNYAAFQRLY----GGATPYLSAWP----------YAAAAAAQS 479
            ||||||||||..:.||.|.   :.|..::.:    ||....|...|          .||||||.:
  Fly   209 QNRRTKWKRQNQLRLEQLR---HQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASN 270

  Fly   480 PHGATPSAIDIYYRQAAAAAAM 501
            |         ..:..:|||||:
  Fly   271 P---------CNFLTSAAAAAI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 34/51 (67%)
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
43.810

Return to query results.
Submit another query.