DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and HOXA10

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens


Alignment Length:122 Identity:41/122 - (33%)
Similarity:64/122 - (52%) Gaps:9/122 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 GSGNGNMLLGGPGSSISGDQASTIDDSDSDDCGGKDDDGDDSMKNGSSANGDSSSHLSLSLSKKQ 380
            |||.|:.  |...:..|...|..:..:.|:  ..|.....||:  |:|...::::.|:   :|..
Human   281 GSGGGSQ--GDEEAHASSSAAEELSPAPSE--SSKASPEKDSL--GNSKGENAANWLT---AKSG 336

  Fly   381 RKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKR 437
            ||.|..:|.||...|||.|....||:.:.|:|::..:.|:|.|||.|:||||.|.|:
Human   337 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 25/55 (45%)
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 16/66 (24%)
Homeodomain 337..393 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.