powered by:
Protein Alignment B-H2 and TLX2
DIOPT Version :9
Sequence 1: | NP_523386.1 |
Gene: | B-H2 / 32723 |
FlyBaseID: | FBgn0004854 |
Length: | 645 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_057254.1 |
Gene: | TLX2 / 3196 |
HGNCID: | 5057 |
Length: | 284 |
Species: | Homo sapiens |
Alignment Length: | 62 |
Identity: | 35/62 - (56%) |
Similarity: | 47/62 - (75%) |
Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 379 KQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTA 440
|::|.||:|:..|:..||:.|.|||||:..:|..||..|.::|.|||||:|||||||:||||
Human 156 KRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTA 217
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0488 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.